General Information

  • ID:  hor004057
  • Uniprot ID:  P09971
  • Protein name:  Pheromone biosynthesis-activating neuropeptide I
  • Gene name:  NA
  • Organism:  Bombyx mori (Silk moth)
  • Family:  Pyrokinin family
  • Source:  Animal
  • Expression:  Expression is restricted to the subesophageal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0016084 myostimulatory hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0042811 pheromone biosynthetic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
  • Length:  33(126-158)
  • Propeptide:  MYKTNIVFNVLALALFSIFFASCTDMKDESDRGAHSERGALWFGPRLGKRSMKPSTEDNRQTFLRLLEAADALKFYYDQLPYERQADEPETKVTKKIIFTPKLGRSVAKPQTHESLEFIPRLGRRLSEDMPATPADQEMYQPDPEEMESRTRYFSPRLGRTMSFSPRLGRELSYDYPTKYRVARSVNKTMDN
  • Signal peptide:  MYKTNIVFNVLALALFSIFFASC
  • Modification:  T33 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  A hormone that controls sex pheromone production in females and pheromone responsiveness in male. Also mediates visceral muscle contractile activity (myotropic activity). be implicated in the formation of both melanin in the cuticle and ommochrome in the
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09971-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004057_AF2.pdbhor004057_ESM.pdb

Physical Information

Mass: 448922 Formula: C167H254N44O59S3
Absent amino acids: CGHIKNVW Common amino acids: EP
pI: 3.88 Basic residues: 3
Polar residues: 7 Hydrophobic residues: 5
Hydrophobicity: -130.91 Boman Index: -10818
Half-Life / Aliphatic Index: 5.5 hour Aliphatic Index: 29.7
Instability Index: 9591.21 Extinction Coefficient cystines: 2980
Absorbance 280nm: 93.13

Literature

  • PubMed ID:  2775285
  • Title:  Amino acid sequence of pheromone-biosynthesis-activating neuropeptide (PBAN) of the silkworm, Bombyx mori.
  • PubMed ID:  8512566
  • Title:  Active conformation of the pyrokinin/PBAN neuropeptide family for pheromone biosynthesis in the silkworm.